LL-37 Peptide Specifications – Purity, Identity & Documentation Guide

Understanding LL-37 peptide specifications is essential when comparing research products.

A product listing may include a peptide name, quantity, purity percentage, and price, but these specifications answer different questions.

Researchers should evaluate them individually before making a procurement decision.

What Is LL-37?

LL-37 is a 37-amino-acid human cathelicidin-derived peptide.

The sequence is:

[LL-37, 37 aa]

It is derived from the human cathelicidin precursor hCAP18.

Accurate compound identity should be the first specification evaluated.

Specification 1: Product Identity

The product should clearly correspond to:

LL-37

Researchers shouldn’t identify a peptide only by broad descriptions such as:

“immune research peptide”

“host-defense peptide.”

Those descriptions provide research context but don’t replace molecular identity.

Specification 2: Sequence

The LL-37 sequence provides an important molecular reference.

Researchers should ensure that sequence information, where provided, corresponds to the intended 37-residue peptide.

Specification 3: Quantity

The listed quantity tells researchers how much material is supplied.

A 5mg product can be reviewed here:

https://peptideslabus.com/products/ll-37-5mg-research-peptide

The 5mg quantity shouldn’t be confused with purity or concentration.

Specification 4: Purity

A purity percentage may provide useful analytical information.

Researchers should determine:

What percentage is reported?
Which analytical method produced it?
Which batch was tested?
Is supporting data available?

Specification 5: HPLC

High-performance liquid chromatography is commonly used for peptide analysis.

HPLC can provide information regarding chromatographic purity.

Researchers should review the result in the context of the method and sample.

Specification 6: Identity Testing

Purity doesn’t automatically establish complete molecular identity.

Researchers should examine available analytical information intended to support the identity of LL-37.

Specification 7: Certificate of Analysis

A COA can summarize product and analytical information.

Depending on the document, it may include:

Compound
Batch
Purity
Analytical methods
Test results
Other specifications

Researchers should review what the COA actually reports.

Specification 8: Batch or Lot

A batch identifier can help connect the research product with its analytical documentation.

This improves traceability.

Researchers should avoid assuming that a test result from one batch automatically applies to another.

Specification 9: Price

Current pricing should be verified using live product pages.

Browse LL-37:

https://peptideslabus.com/products?q=LL-37

Price should be compared with product specifications rather than considered alone.

Specification 10: Availability

Product availability can change.

Researchers should check the current catalog immediately before procurement.

Additional LL-37 Listings

Researchers can also review:

https://peptideslabus.com/products/crown-ll-37-research-peptide

and:

https://peptideslabus.com/products/peptides-lab-ll37

Each listing should be evaluated according to its current specifications and documentation.

Purity Isn’t Quantity

This distinction is important.

5mg describes listed quantity.

A purity percentage describes an analytical result.

They aren’t interchangeable specifications.

Purity Isn’t Identity

Likewise:

purity

and

molecular identity

aren’t the same analytical question.

Researchers should evaluate both.

LL-37 vs hCAP18

hCAP18 is the human cathelicidin precursor.

LL-37 is the mature 37-residue peptide derived from it.

This distinction matters when reading research literature and evaluating product identity.

Research Context Isn’t a Product Specification

LL-37 has been investigated in areas including:

Innate immunity
Host-defense biology
Microbial interactions
Inflammatory signaling
Cytokine pathways
Epithelial models
Cellular responses

These describe research contexts.

They don’t establish commercial product purity, identity, or quality.

LL-37 Specification Checklist

Before ordering, verify:

Compound: LL-37

Sequence: Correct 37-residue peptide

Quantity: Listed amount

Purity: Reported analytical result

HPLC: Available chromatographic information

Identity testing: Supporting molecular information

COA: Relevant certificate

Batch: Applicable lot information

Price: Current live price

Availability: Current listing status

Browse LL-37 Products